Loading...
Statistics
Advertisement

wajaclub.com - Diese Website steht zum Verkauf! -& ...
www.wajaclub.com/
Diese

Wajaclub.com

Domain is redirected to: Ww1.wajaclub.com
Advertisement
Conversion Technology Metas Server
Wajaclub.com is hosted in Germany . Wajaclub.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: Html, Html5, Javascript, Number of used javascripts: 3. First javascripts: Jquery-1.11.3.custom.min.js, Caf.js, Iam.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Wajaclub.com

Technology

Number of occurences: 5
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 3
  • jquery-1.11.3.custom.min.js
  • caf.js
  • iam.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache

Powered by

  • PHP/5.4.45-0+deb7u3

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Wajaclub.com

Missing HTTPS protocol.

    Meta - Wajaclub.com

    Number of occurences: 5
    • Name:
      Content: 0; url=http://ww1.wajaclub.com//?gtnjs=1
    • Name: GOOGLEBOT
      Content: index, follow, all
    • Name: robots
      Content: index, follow, all
    • Name: viewport
      Content: width=device-width,initial-scale=1,maximum-scale=1,user-scalable=0
    • Name: description
      Content: Diese

    Server / Hosting

    • IP: 91.195.240.82
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns2.above.com
    • ns1.above.com
    • mail.post-host.net

    Target

    • hostmaster.trellian.com

    HTTP Header Response

    HTTP/1.1 302 Found Date: Mon, 20 Jun 2016 18:05:44 GMT Server: Apache X-Powered-By: PHP/5.4.45-0+deb7u3 Set-Cookie: __tad=1466445944.7229411; expires=Thu, 18-Jun-2026 18:05:44 GMT Location: http://ww1.wajaclub.com/ Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive HTTP/1.1 200 OK Server: nginx Date: Mon, 20 Jun 2016 18:05:44 GMT Content-Type: text/html; charset=UTF-8 Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Mon, 20 Jun 2016 18:05:44 GMT Cache-Control: no-store, no-cache, must-revalidate Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding X-Cache: MISS from 120233 X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

    DNS

    host: wajaclub.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 103.224.182.245
    host: wajaclub.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.above.com
    host: wajaclub.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.above.com
    host: wajaclub.com
    1. class: IN
    2. ttl: 60
    3. type: SOA
    4. mname: ns1.above.com
    5. rname: hostmaster.trellian.com
    6. serial: 2016062101
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: wajaclub.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 1
    5. target: mail.post-host.net
    host: wajaclub.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: v=spf1 ip6:fdcf:abda:4154::/48 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ajaclub.com, www.w ajaclub.com, www. ajaclub.com, www.wcajaclub.com, www.cajaclub.com, www.wajaclub.com, www.ajaclub.com, www.wdajaclub.com, www.dajaclub.com, www.wfajaclub.com, www.fajaclub.com, www.wgajaclub.com, www.gajaclub.com, www.wbajaclub.com, www.bajaclub.com, www.wjaclub.com, www.waojaclub.com, www.wojaclub.com, www.wapjaclub.com, www.wpjaclub.com, www.wa9jaclub.com, www.w9jaclub.com, www.wajaclub.com, www.wjaclub.com, www.waijaclub.com, www.wijaclub.com, www.waujaclub.com, www.wujaclub.com, www.waaclub.com, www.wajzaclub.com, www.wazaclub.com, www.wajhaclub.com, www.wahaclub.com, www.wajnaclub.com, www.wanaclub.com, www.waj.aclub.com, www.wa.aclub.com, www.wajuaclub.com, www.wauaclub.com, www.wajkaclub.com, www.wakaclub.com, www.wajlaclub.com, www.walaclub.com, www.wajoaclub.com, www.waoaclub.com, www.wajclub.com, www.wajaoclub.com, www.wajoclub.com, www.wajapclub.com, www.wajpclub.com, www.waja9club.com, www.waj9club.com, www.wajaclub.com, www.wajclub.com, www.wajaiclub.com, www.wajiclub.com, www.wajauclub.com, www.wajuclub.com, www.wajalub.com, www.wajacdlub.com, www.wajadlub.com, www.wajacrlub.com, www.wajarlub.com, www.wajactlub.com, www.wajatlub.com, www.wajacvlub.com, www.wajavlub.com, www.wajacflub.com, www.wajaflub.com, www.wajacglub.com, www.wajaglub.com, www.wajachlub.com, www.wajahlub.com, www.wajacnlub.com, www.wajanlub.com, www.wajacmlub.com, www.wajamlub.com, www.wajacjlub.com, www.wajajlub.com, www.wajacub.com, www.wajacluub.com, www.wajacuub.com, www.wajacl8ub.com, www.wajac8ub.com, www.wajacl9ub.com, www.wajac9ub.com, www.wajacljub.com, www.wajacjub.com, www.wajacl0ub.com, www.wajac0ub.com, www.wajaclmub.com, www.wajacmub.com, www.wajaclpub.com, www.wajacpub.com, www.wajacloub.com, www.wajacoub.com, www.wajaclb.com, www.wajacluwb.com, www.wajaclwb.com, www.wajaclueb.com, www.wajacleb.com, www.wajaclusb.com, www.wajaclsb.com, www.wajacluab.com, www.wajaclab.com, www.wajaclu.com, www.wajaclubq.com, www.wajacluq.com, www.wajaclubw.com, www.wajacluw.com, www.wajaclubz.com, www.wajacluz.com, www.wajaclubx.com, www.wajaclux.com, www.wajaclub.com, www.wajaclu.com, www.wajaclubs.com, www.wajaclus.com, www.wajacluby.com, www.wajacluy.com, www.wajaclube.com, www.wajaclue.com, www.wajaclubd.com, www.wajaclud.com, www.wajaclubc.com, www.wajacluc.com,

    Other websites we recently analyzed

    1. Myke Walker's Website
      Lake Mary (United States) - 208.94.116.143
      Server software: Apache
      Technology: CSS, Fancybox, Html, Javascript, jQuery Fancybox, Php
      Number of Javascript: 10
      Number of meta tags: 4
    2. Riccione mare.it: i nostri Hotel fronte mare nel centro di Riccione per vacanze e weekend sulla spiaggia
      Riccione Mare è il portale per le Sue vacanze ed i Suoi weekend a Riccione: presenta hotel di Riccione 3 e 4 stelle sul mare e nel centro a Riccione, ed i servizi di ospitalità del Gruppo Atlantic
      Italy - 217.70.144.128
      Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 PHP/5.4.31
      Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 3
    3. resideceondablu.es
      France - 94.23.200.8
      Server software: nginx
      Technology: Html
      Number of meta tags: 1
    4. Stile Grafico - Lissone - Monza
      Stile Grafico da oltre 20 anni opera nella provincia di Monza nel settore della comunicazione grafica visiva con professionalità e riconosciuta esperienza.
      Milan (Italy) - 212.48.12.143
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
      Number of Javascript: 39
      Number of meta tags: 5
    5. karton22.ru
      Russian Federation - 82.146.43.141
      Server software: Apache/2.4.10 (Debian)
      Technology: Html
    6. electricknifesharpenerreviews.com
      Frankfurt (Germany) - 149.126.77.93
      Server software:
      Technology: Html, Iframe, Incapsula, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    7. injunctionagainstharassment.com
      Scottsdale (United States) - 50.63.202.51
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    8. MarketSurf by Stella MORABITO
      Mountain View (United States) - 172.217.22.51
      Server software: GSE
      Technology: CSS, Feedburner, Html, Javascript, Php, Geovisite, Google +1 Button
      Number of Javascript: 7
      Number of meta tags: 2
    9. Millennial Wealth Advisors -
      San Antonio (United States) - 162.242.223.227
      G Analytics ID: UA-61857809-1
      Server software: nginx
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 8
      Number of meta tags: 5
    10. 常州市景华纺织有限公司
      Orange (United States) - 98.126.56.66
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Swf Object
      Number of meta tags: 1

    Check Other Websites